Brand: | Abnova |
Reference: | H00153201-M04 |
Product name: | SLC36A2 monoclonal antibody (M04), clone 2H3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SLC36A2. |
Clone: | 2H3 |
Isotype: | IgG2b Kappa |
Gene id: | 153201 |
Gene name: | SLC36A2 |
Gene alias: | FLJ16051|MGC119658|MGC119660|PAT2|TRAMD1 |
Gene description: | solute carrier family 36 (proton/amino acid symporter), member 2 |
Genbank accession: | NM_181776 |
Immunogen: | SLC36A2 (NP_861441, 1 a.a. ~ 71 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSVTKSTEGPQGAVAIKLDLMSPPESAKKLENKDSTFLDESPSESAGLKKTKGITVFQALIHLVKGNMGTG |
Protein accession: | NP_861441 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.55 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | SLC36A2 monoclonal antibody (M04), clone 2H3. Western Blot analysis of SLC36A2 expression in A-431 ( Cat # L015V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |