Cart 28 Product Products 11 892,00 € (empty)
No products
To be determined Shipping
11 892,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 28 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 11 892,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 11 892,00 €
Data sheet of RASGEF1B purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about RASGEF1B purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00153020-B01P |
| Product name: | RASGEF1B purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human RASGEF1B protein. |
| Gene id: | 153020 |
| Gene name: | RASGEF1B |
| Gene alias: | FLJ31695|GPIG4|MGC46251 |
| Gene description: | RasGEF domain family, member 1B |
| Genbank accession: | BC036784 |
| Immunogen: | RASGEF1B (AAH36784.1, 1 a.a. ~ 210 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MPQTPPFSAMFDSSGYNRNLYQSAEDSCGGLYYHDNNLLSGSLEALIQHLVPNVDYYPDRTYIFTFLLSSRLFMHPYELMAKVCHLCVEHQRLSDPDSDKNQMRKIAPKILQLLTEWTETFPYDFRDERMMRNLKDLAHRIASGEEVGNLNLARLLEFPGRAWVGNGAELCILISTASSLFCLWASPPHHILVYLVCQVRMIIPSHFKGI |
| Protein accession: | AAH36784.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of RASGEF1B expression in transfected 293T cell line (H00153020-T02) by RASGEF1B MaxPab polyclonal antibody. Lane 1: RASGEF1B transfected lysate(23.1 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |