Brand: | Abnova |
Reference: | H00152330-M06 |
Product name: | CNTN4 monoclonal antibody (M06), clone 4B10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CNTN4. |
Clone: | 4B10 |
Isotype: | IgG2a Kappa |
Gene id: | 152330 |
Gene name: | CNTN4 |
Gene alias: | AXCAM|BIG-2|CNTN4A|MGC33615 |
Gene description: | contactin 4 |
Genbank accession: | NM_175607 |
Immunogen: | CNTN4 (NP_783200.1, 800 a.a. ~ 898 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EPTKPPASIFARSLSATDIEVFWASPLEKNRGRIQGYEVKYWRHEDKEENARKIRTVGNQTSTKITNLKGSVLYHLAVKAYNSAGTGPSSATVNVTTRK |
Protein accession: | NP_783200.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged CNTN4 is 0.03 ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA |
Shipping condition: | Dry Ice |