ROPN1B MaxPab mouse polyclonal antibody (B01) View larger

ROPN1B MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ROPN1B MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about ROPN1B MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00152015-B01
Product name: ROPN1B MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human ROPN1B protein.
Gene id: 152015
Gene name: ROPN1B
Gene alias: -
Gene description: ropporin, rhophilin associated protein 1B
Genbank accession: NM_001012337
Immunogen: ROPN1B (NP_001012337, 1 a.a. ~ 212 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAQTDKPTCIPPELPKMLKEFAKAAIRAQPQDLIQWGADYFEALSRGETPPVRERSERVALCNWAELTPELLKILHSQVAGRLIIRAEELAQMWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKIVCEVLSCDHNGGLPRIPFSTFQFLYTYIAEVDGEICASHVSRMLNYIEQEVIGPDGLITVNDFTQNPRVWLE
Protein accession: NP_001012337
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00152015-B01-13-15-1.jpg
Application image note: Western Blot analysis of ROPN1B expression in transfected 293T cell line (H00152015-T01) by ROPN1B MaxPab polyclonal antibody.

Lane 1: ROPN1B transfected lysate(23.32 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ROPN1B MaxPab mouse polyclonal antibody (B01) now

Add to cart