BTLA monoclonal antibody (M03), clone 2G8 View larger

BTLA monoclonal antibody (M03), clone 2G8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BTLA monoclonal antibody (M03), clone 2G8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about BTLA monoclonal antibody (M03), clone 2G8

Brand: Abnova
Reference: H00151888-M03
Product name: BTLA monoclonal antibody (M03), clone 2G8
Product description: Mouse monoclonal antibody raised against a partial recombinant BTLA.
Clone: 2G8
Isotype: IgG2b Kappa
Gene id: 151888
Gene name: BTLA
Gene alias: BTLA1|CD272|FLJ16065|MGC129743
Gene description: B and T lymphocyte associated
Genbank accession: NM_181780
Immunogen: BTLA (NP_861445, 190 a.a. ~ 289 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DTAGREINLVDAHLKSEQTEASTRQNSQVLLSETGIYDNDPDLCFRMQEGSEVYSNPCLEENKPGIVYASLNHSVIGPNSRLARNVKEAPTEYASICVRS
Protein accession: NP_861445
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00151888-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy BTLA monoclonal antibody (M03), clone 2G8 now

Add to cart