Brand: | Abnova |
Reference: | H00151888-M02 |
Product name: | BTLA monoclonal antibody (M02), clone 1B7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant BTLA. |
Clone: | 1B7 |
Isotype: | IgG2a Kappa |
Gene id: | 151888 |
Gene name: | BTLA |
Gene alias: | BTLA1|CD272|FLJ16065|MGC129743 |
Gene description: | B and T lymphocyte associated |
Genbank accession: | NM_181780 |
Immunogen: | BTLA (NP_861445, 190 a.a. ~ 289 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | DTAGREINLVDAHLKSEQTEASTRQNSQVLLSETGIYDNDPDLCFRMQEGSEVYSNPCLEENKPGIVYASLNHSVIGPNSRLARNVKEAPTEYASICVRS |
Protein accession: | NP_861445 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |