Cart 2 Product Products 193,34 € (empty)
No products
To be determined Shipping
193,34 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 2 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 193,34 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 193,34 €
Data sheet of DPPA2 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,WB-Tr |
More info about DPPA2 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00151871-B01P |
| Product name: | DPPA2 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human DPPA2 protein. |
| Gene id: | 151871 |
| Gene name: | DPPA2 |
| Gene alias: | PESCRG1 |
| Gene description: | developmental pluripotency associated 2 |
| Genbank accession: | BC018070 |
| Immunogen: | DPPA2 (AAH18070.1, 1 a.a. ~ 298 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MSDANLDSSKKNFLEGEVDDEESVILTLVPVKDDANMEQMEPSVSSTSDVKLEKPKKYNPGHLLQTNEQFTAPQKARCKIPALPLPTILPPINKVCRDTLRDWCQQLGLSTNGKKIEVYLRLHRHAYPEQRQDMPEMSQETRLQRCSRKRKAVTKRARLQRSYEMNERAEETNTVEVITSAPGAMLASWARIAARAVQPKALNSCSIPVSVEAFLMQASGVRWCVVHGRLLSADTKGWVRLQFHAGQAWVPTTHRRMISLFLLPACIFPSPGIEDNMLCPDCAKRNKKMMKRLMTVEK |
| Protein accession: | AAH18070.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of DPPA2 expression in transfected 293T cell line (H00151871-T02) by DPPA2 MaxPab polyclonal antibody. Lane 1: DPPA2 transfected lysate(32.78 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ce,WB-Tr |
| Shipping condition: | Dry Ice |