DPPA2 MaxPab mouse polyclonal antibody (B01) View larger

DPPA2 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DPPA2 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,WB-Tr

More info about DPPA2 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00151871-B01
Product name: DPPA2 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human DPPA2 protein.
Gene id: 151871
Gene name: DPPA2
Gene alias: PESCRG1
Gene description: developmental pluripotency associated 2
Genbank accession: BC018070
Immunogen: DPPA2 (AAH18070, 1 a.a. ~ 298 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSDANLDSSKKNFLEGEVDDEESVILTLVPVKDDANMEQMEPSVSSTSDVKLEKPKKYNPGHLLQTNEQFTAPQKARCKIPALPLPTILPPINKVCRDTLRDWCQQLGLSTNGKKIEVYLRLHRHAYPEQRQDMPEMSQETRLQRCSRKRKAVTKRARLQRSYEMNERAEETNTVEVITSAPGAMLASWARIAARAVQPKALNSCSIPVSVEAFLMQASGVRWCVVHGRLLSADTKGWVRLQFHAGQAWVPTTHRRMISLFLLPACIFPSPGIEDNMLCPDCAKRNKKMMKRLMTVEK
Protein accession: AAH18070
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00151871-B01-13-15-1.jpg
Application image note: Western Blot analysis of DPPA2 expression in transfected 293T cell line (H00151871-T01) by DPPA2 MaxPab polyclonal antibody.

Lane 1: DPPA2 transfected lysate(32.78 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy DPPA2 MaxPab mouse polyclonal antibody (B01) now

Add to cart