Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SGOL1 monoclonal antibody (M01), clone 3C11
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re,WB-Tr,IP |
More info about SGOL1 monoclonal antibody (M01), clone 3C11
| Brand: | Abnova |
| Reference: | H00151648-M01 |
| Product name: | SGOL1 monoclonal antibody (M01), clone 3C11 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant SGOL1. |
| Clone: | 3C11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 151648 |
| Gene name: | SGOL1 |
| Gene alias: | NY-BR-85|SGO|Sgo1 |
| Gene description: | shugoshin-like 1 (S. pombe) |
| Genbank accession: | BC017867 |
| Immunogen: | SGOL1 (AAH17867, 1 a.a. ~ 292 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAKERCLKKSFQDSLEDIKKRMKEKRNKNLAEIGKRRSFIAAPCQIITNTSTLLKNYQDNNKMLVLALENEKSKVKEAQDIILQLRKECYYLTCQLYALKGKLTSQQTVEPAQNQEICSSGMDPNSDDSSRNLFVKDLPQIPLEETELPGQGESFQIEATPPETQQSPHLSLKDITNVSLYPVVKIRRLSLSPKKNKASPAVALPKRRCTASVNYKEPTLASKLRRGDPFTDLCFLNSPIFKQKKDLRRSKKRALEVSPAKEAIFILYYVREFVSRFPDCRKCKLETHICLR |
| Protein accession: | AAH17867 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (57.86 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | Immunoprecipitation of SGOL1 transfected lysate using anti-SGOL1 monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with SGOL1 MaxPab rabbit polyclonal antibody. |
| Applications: | WB-Ce,ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |
| Publications: | Chromosome segregation regulation in human zygotes: altered mitotic histone phosphorylation dynamics underlying centromeric targeting of the chromosomal passenger complex.C. van de Werken1, M. Avo Santos, J.S.E. Laven, C. Eleveld, B.C.J.M. Fauser, S.M.A. Lens and E.B. Baart. Hum Reprod. 2015 Jul 29. [Epub ahead of print] |