DTX3L polyclonal antibody (A01) View larger

DTX3L polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DTX3L polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about DTX3L polyclonal antibody (A01)

Brand: Abnova
Reference: H00151636-A01
Product name: DTX3L polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant DTX3L.
Gene id: 151636
Gene name: DTX3L
Gene alias: BBAP
Gene description: deltex 3-like (Drosophila)
Genbank accession: NM_138287
Immunogen: DTX3L (NP_612144, 3 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: SHLRPPSPLLVRVYKSGPRVRRKLESYFQSSKSSGGGECTVSTQEHEAPGTFRVEFSERAAKERVLKKGEHQILVDEKPVPIFLVPTENSIKKNTRPQISSLTQSQAE
Protein accession: NP_612144
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00151636-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.99 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00151636-A01-1-4-1.jpg
Application image note: DTX3L polyclonal antibody (A01), Lot # ABNOVA060707QCS1 Western Blot analysis of DTX3L expression in A-431 ( Cat # L015V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy DTX3L polyclonal antibody (A01) now

Add to cart