Brand: | Abnova |
Reference: | H00151449-M11 |
Product name: | GDF7 monoclonal antibody (M11), clone 2A2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant GDF7. |
Clone: | 2A2 |
Isotype: | IgG2a Kappa |
Gene id: | 151449 |
Gene name: | GDF7 |
Gene alias: | BMP12 |
Gene description: | growth differentiation factor 7 |
Genbank accession: | NM_182828 |
Immunogen: | GDF7 (NP_878248.2, 204 a.a. ~ 301 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VGQRWEAFDVADAMRRHRREPRPPRAFCLLLRAVAGPVPSPLALRRLGFGWPGGGGSAAEERAVLVVSSRTQRKESLFREIRAQARALGAALASEPLP |
Protein accession: | NP_878248.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |