GDF7 monoclonal antibody (M05), clone 3E3 View larger

GDF7 monoclonal antibody (M05), clone 3E3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GDF7 monoclonal antibody (M05), clone 3E3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about GDF7 monoclonal antibody (M05), clone 3E3

Brand: Abnova
Reference: H00151449-M05
Product name: GDF7 monoclonal antibody (M05), clone 3E3
Product description: Mouse monoclonal antibody raised against a partial recombinant GDF7.
Clone: 3E3
Isotype: IgG2a Kappa
Gene id: 151449
Gene name: GDF7
Gene alias: BMP12
Gene description: growth differentiation factor 7
Genbank accession: NM_182828
Immunogen: GDF7 (NP_878248, 361 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARLSPISILYIDAANNVVYKQYEDMVVEACGCR
Protein accession: NP_878248
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00151449-M05-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged GDF7 is approximately 3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy GDF7 monoclonal antibody (M05), clone 3E3 now

Add to cart