PPP1R1C purified MaxPab rabbit polyclonal antibody (D01P) View larger

PPP1R1C purified MaxPab rabbit polyclonal antibody (D01P)

H00151242-D01P_100ug

New product

384,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PPP1R1C purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsIF,WB-Tr

More info about PPP1R1C purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00151242-D01P
Product name: PPP1R1C purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human PPP1R1C protein.
Gene id: 151242
Gene name: PPP1R1C
Gene alias: IPP5
Gene description: protein phosphatase 1, regulatory (inhibitor) subunit 1C
Genbank accession: XM_087137.8
Immunogen: PPP1R1C (NP_001074014.1, 1 a.a. ~ 109 a.a) full-length human protein.
Immunogen sequence/protein sequence: MEPNSPKKIQFAVPVFQSQIAPEAAEQIRKRRPTPASLVILNEHNPPEIDDKRGPNTQGELQNASPKQRKQSVYTPPTIKGVKHLKGQNESAFPEEEEGTNEREEQRDH
Protein accession: NP_001074014.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00151242-D01P-13-15-1.jpg
Application image note: Western Blot analysis of PPP1R1C expression in transfected 293T cell line (H00151242-T02) by PPP1R1C MaxPab polyclonal antibody.

Lane 1: PPP1R1C transfected lysate(12.30 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PPP1R1C purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart