ZSWIM2 monoclonal antibody (M01), clone 2G4 View larger

ZSWIM2 monoclonal antibody (M01), clone 2G4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZSWIM2 monoclonal antibody (M01), clone 2G4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about ZSWIM2 monoclonal antibody (M01), clone 2G4

Brand: Abnova
Reference: H00151112-M01
Product name: ZSWIM2 monoclonal antibody (M01), clone 2G4
Product description: Mouse monoclonal antibody raised against a partial recombinant ZSWIM2.
Clone: 2G4
Isotype: IgG2a Kappa
Gene id: 151112
Gene name: ZSWIM2
Gene alias: MGC33890|ZZZ2
Gene description: zinc finger, SWIM-type containing 2
Genbank accession: NM_182521
Immunogen: ZSWIM2 (NP_872327.2, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MLRRGYKASERRRHLSERLSWHQDQALSSSIYLLREMGPTGFLLREEEPEYMDFRVFLGNPHVCNCSTFPKGGELCKHICWVLLKKFKLPRNHESALQL
Protein accession: NP_872327.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00151112-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged ZSWIM2 is 0.3 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy ZSWIM2 monoclonal antibody (M01), clone 2G4 now

Add to cart