Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00150297-B02 |
Product name: | RP1-127L4.6 MaxPab mouse polyclonal antibody (B02) |
Product description: | Mouse polyclonal antibody raised against a full-length human RP1-127L4.6 protein. |
Gene id: | 150297 |
Gene name: | RP1-127L4.6 |
Gene alias: | LOC150297|dJ90G24.6 |
Gene description: | hypothetical protein LOC150297 |
Genbank accession: | BC139845 |
Immunogen: | RP1-127L4.6 (CAG30371.1, 1 a.a. ~ 256 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MGSKLTCCLGPSGGLNCDCCRPDVGPCHECEIPETVAATAPASTTAKPAKLDLKAKKAQLMQYLSLPKTPKMLKMSKGLDARSKRWLKIIWRRHGIWPLENIGPTEDVQASAHGGVEENMTSDIEIPEAKHDHRPTEDVQVSAHGGVEENITSDIEISEAKHDHHLVEDLSESLSVCLEDFMTSDLSESLSVSLEDFMTSGLSESLSVSLEDLMTPEMAKERYEDYLCWVKMARSRLNEPISSQVLGLLRLPTFLY |
Protein accession: | CAG30371.1 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of RP1-127L4.6 expression in transfected 293T cell line (H00150297-T02) by RP1-127L4.6 MaxPab polyclonal antibody. Lane 1: RP1-127L4.6 transfected lysate(27.61 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |