Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SIK1 monoclonal antibody (M01), clone 2C12
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,IF,S-ELISA,ELISA |
More info about SIK1 monoclonal antibody (M01), clone 2C12
| Brand: | Abnova |
| Reference: | H00150094-M01 |
| Product name: | SIK1 monoclonal antibody (M01), clone 2C12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SIK1. |
| Clone: | 2C12 |
| Isotype: | IgG2a Kappa |
| Gene id: | 150094 |
| Gene name: | SIK1 |
| Gene alias: | MSK|SIK|SNF1LK |
| Gene description: | salt-inducible kinase 1 |
| Genbank accession: | BC038504 |
| Immunogen: | SIK1 (AAH38504.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MVIMSEFSADPAGQGQGQQKPLRVGFYDIERTLGKGNFAVVKLARHRVTKTQVAIKIIDKTRLDSSNLEKIYREVQLMKLLNHPHIIKLYQVMETKDMLY |
| Protein accession: | AAH38504.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to SIK1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,IF,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |
| Publications: | De Novo Mutations in SIK1 Cause a Spectrum of Developmental Epilepsies.Hansen J, Snow C, Tuttle E, Ghoneim DH, Yang CS, Spencer A, Gunter SA, Smyser CD, Gurnett CA, Shinawi M, Dobyns WB, Wheless J, Halterman MW, Jansen LA, Paschal BM, Paciorkowski AR Am J Hum Genet. 2015 Apr 2;96(4):682-90. doi: 10.1016/j.ajhg.2015.02.013. |