Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00149699-M03 |
Product name: | GTSF1L monoclonal antibody (M03), clone 5E7 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant GTSF1L. |
Clone: | 5E7 |
Isotype: | IgG2a Kappa |
Gene id: | 149699 |
Gene name: | GTSF1L |
Gene alias: | C20orf65|FAM112A|MGC50820|dJ1028D15.4 |
Gene description: | gametocyte specific factor 1-like |
Genbank accession: | NM_176791.3 |
Immunogen: | GTSF1L (NP_789761.1, 1 a.a. ~ 148 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MEPEAFEICPYDPHHRIPLSRFQYHLASCRRKNPKKAKKMATCKYNACHVVPIKNLEEHEAVCVNRSAVEEEDTENPLKVSPPSSEQNDDTQQVSPCLPSPDIWNVDGANCQHVFVLKTFFPQKVVCENDTKESARETSPQKILRPGQ |
Protein accession: | NP_789761.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (43.3 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of GTSF1L expression in transfected 293T cell line by GTSF1L monoclonal antibody (M03), clone 5E7. Lane 1: GTSF1L transfected lysate (Predicted MW: 16.9 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |