Brand: | Abnova |
Reference: | H00149420-M01 |
Product name: | PDIK1L monoclonal antibody (M01), clone 4B7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PDIK1L. |
Clone: | 4B7 |
Isotype: | IgG1 Kappa |
Gene id: | 149420 |
Gene name: | PDIK1L |
Gene alias: | CLIK1L|RP11-96L14.4 |
Gene description: | PDLIM1 interacting kinase 1 like |
Genbank accession: | NM_152835 |
Immunogen: | PDIK1L (NP_690048, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MVSSQPKYDLIREVGRGSYGVVYEAVIRKTSARVAVKKIRCHAPENVELALREFWALSSIKSQHPNVIHLEECILQKDGMVQKMSHGSNSSLYLQLVET |
Protein accession: | NP_690048 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged PDIK1L is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |