Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PDIK1L monoclonal antibody (M01), clone 4B7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA |
More info about PDIK1L monoclonal antibody (M01), clone 4B7
| Brand: | Abnova |
| Reference: | H00149420-M01 |
| Product name: | PDIK1L monoclonal antibody (M01), clone 4B7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PDIK1L. |
| Clone: | 4B7 |
| Isotype: | IgG1 Kappa |
| Gene id: | 149420 |
| Gene name: | PDIK1L |
| Gene alias: | CLIK1L|RP11-96L14.4 |
| Gene description: | PDLIM1 interacting kinase 1 like |
| Genbank accession: | NM_152835 |
| Immunogen: | PDIK1L (NP_690048, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MVSSQPKYDLIREVGRGSYGVVYEAVIRKTSARVAVKKIRCHAPENVELALREFWALSSIKSQHPNVIHLEECILQKDGMVQKMSHGSNSSLYLQLVET |
| Protein accession: | NP_690048 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged PDIK1L is 0.3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |