Brand: | Abnova |
Reference: | H00149095-M04 |
Product name: | DCST1 monoclonal antibody (M04), clone 2C12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DCST1. |
Clone: | 2C12 |
Isotype: | IgG2a Kappa |
Gene id: | 149095 |
Gene name: | DCST1 |
Gene alias: | FLJ32785|RP11-307C12.10 |
Gene description: | DC-STAMP domain containing 1 |
Genbank accession: | NM_152494 |
Immunogen: | DCST1 (NP_689707, 532 a.a. ~ 630 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MESNNMPCLPQPVGLDARAYWRAAVPIGLLVCLCLLQAFGYRLRRVIAAFYFPKREKKRILFLYNDLLKKRAAFTKLRRAAILRRERQQKAPRHPLADI |
Protein accession: | NP_689707 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged DCST1 is 1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |