HFE2 purified MaxPab mouse polyclonal antibody (B01P) View larger

HFE2 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HFE2 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about HFE2 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00148738-B01P
Product name: HFE2 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human HFE2 protein.
Gene id: 148738
Gene name: HFE2
Gene alias: HFE2A|HJV|JH|MGC23953|RGMC
Gene description: hemochromatosis type 2 (juvenile)
Genbank accession: NM_145277.3
Immunogen: HFE2 (NP_660320.3, 1 a.a. ~ 313 a.a) full-length human protein.
Immunogen sequence/protein sequence: MIQHNCSRQGPTAPPPPRGPALPGAGSGLPAPDPCDYEGRFSRLHGRPPGFLHCASFGDPHVRSFHHHFHTCRVQGAWPLLDNDFLFVQATSSPMALGANATATRKLTIIFKNMQECIDQKVYQAEVDNLPVAFEDGSINGGDRPGGSSLSIQTANPGNHVEIQAAYIGTTIIIRQTAGQLSFSIKVAEDVAMAFSAEQDLQLCVGGCPPSQRLSRSERNRRGAITIDTARRLCKEGLPVEDAYFHSCVFDVLISGDPNFTVAAQAALEDARAFLPDLEKLHLFPSDAGVPLSSATLLAPLLSGLFVLWLCIQ
Protein accession: NP_660320.3
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00148738-B01P-13-15-1.jpg
Application image note: Western Blot analysis of HFE2 expression in transfected 293T cell line (H00148738-T01) by HFE2 MaxPab polyclonal antibody.

Lane 1: HFE2 transfected lysate(34.43 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy HFE2 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart