Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of HFE2 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about HFE2 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00148738-A01 |
| Product name: | HFE2 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant HFE2. |
| Gene id: | 148738 |
| Gene name: | HFE2 |
| Gene alias: | HFE2A|HJV|JH|MGC23953|RGMC |
| Gene description: | hemochromatosis type 2 (juvenile) |
| Genbank accession: | NM_202004 |
| Immunogen: | HFE2 (NP_973733, 93 a.a. ~ 173 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | GGCPPSQRLSRSERNRRGAITIDTARRLCKEGLPVEDAYFHSCVFDVLISGDPNFTVAAQAALEDARAFLPDLEKLHLFPS |
| Protein accession: | NP_973733 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.02 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | HFE2 polyclonal antibody (A01), Lot # 060519JCS1 Western Blot analysis of HFE2 expression in U-2 OS ( Cat # L022V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Regulation of Type II Transmembrane Serine Proteinase TMPRSS6 by Hypoxia-inducible Factors: NEW LINK BETWEEN HYPOXIA SIGNALING AND IRON HOMEOSTASIS.Lakhal S, Schodel J, Townsend AR, Pugh CW, Ratcliffe PJ, Mole DR. J Biol Chem. 2011 Feb 11;286(6):4090-7. Epub 2010 Oct 21. |