Brand: | Abnova |
Reference: | H00148581-M07 |
Product name: | UBE2U monoclonal antibody (M07), clone 3D4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant UBE2U. |
Clone: | 3D4 |
Isotype: | IgG2a Kappa |
Gene id: | 148581 |
Gene name: | UBE2U |
Gene alias: | MGC35130|RP4-636O23.1 |
Gene description: | ubiquitin-conjugating enzyme E2U (putative) |
Genbank accession: | NM_152489.1 |
Immunogen: | UBE2U (NP_689702.1, 9 a.a. ~ 102 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LHRDFCDLKENNYKGITAKPVSEDMMEWEVEIEGLQNSVWQGLVFQLTIHFTSEYNYAPPVVKFITIPFHPNVDPHTGQPCIDFLDNPEKWNTN |
Protein accession: | NP_689702.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged UBE2U is 1 ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA |
Shipping condition: | Dry Ice |