Brand: | Abnova |
Reference: | H00148066-M01 |
Product name: | ZNRF4 monoclonal antibody (M01), clone 1A8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ZNRF4. |
Clone: | 1A8 |
Isotype: | IgG1 Kappa |
Gene id: | 148066 |
Gene name: | ZNRF4 |
Gene alias: | RNF204|SPERIZIN|Ssrzf1|spzn |
Gene description: | zinc and ring finger 4 |
Genbank accession: | NM_181710 |
Immunogen: | ZNRF4 (NP_859061.2, 108 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SSSVDFADLPALFGVPLAPEGIRGYLMEVKPANACHPIEAPRLGNRSLGSIALIRRYDCTFDL |
Protein accession: | NP_859061.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (32.67 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged ZNRF4 is 0.1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |