ZNRF4 monoclonal antibody (M01), clone 1A8 View larger

ZNRF4 monoclonal antibody (M01), clone 1A8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNRF4 monoclonal antibody (M01), clone 1A8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about ZNRF4 monoclonal antibody (M01), clone 1A8

Brand: Abnova
Reference: H00148066-M01
Product name: ZNRF4 monoclonal antibody (M01), clone 1A8
Product description: Mouse monoclonal antibody raised against a partial recombinant ZNRF4.
Clone: 1A8
Isotype: IgG1 Kappa
Gene id: 148066
Gene name: ZNRF4
Gene alias: RNF204|SPERIZIN|Ssrzf1|spzn
Gene description: zinc and ring finger 4
Genbank accession: NM_181710
Immunogen: ZNRF4 (NP_859061.2, 108 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SSSVDFADLPALFGVPLAPEGIRGYLMEVKPANACHPIEAPRLGNRSLGSIALIRRYDCTFDL
Protein accession: NP_859061.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00148066-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (32.67 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00148066-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged ZNRF4 is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ZNRF4 monoclonal antibody (M01), clone 1A8 now

Add to cart