ZNF480 purified MaxPab mouse polyclonal antibody (B01P) View larger

ZNF480 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZNF480 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about ZNF480 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00147657-B01P
Product name: ZNF480 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human ZNF480 protein.
Gene id: 147657
Gene name: ZNF480
Gene alias: MGC32104
Gene description: zinc finger protein 480
Genbank accession: NM_144684.1
Immunogen: ZNF480 (NP_653285.1, 1 a.a. ~ 516 a.a) full-length human protein.
Immunogen sequence/protein sequence: MALPQGHLTFRDVAIEFSQAEWKCLDPAQRALYKDVMLENYRNLVSLGISLPDLNINSMLEQRREPWSGESEVKIAKNSDGRECIKGVNTGSSYALGSNAEDKPIKKQLGVSFHLHLSELELFPDERVINGCNQVENFINHSSSVSCLQEMSSSVKTPIFNRNDFDDSSFLPQEQKVHLREKPYECNEHSKVFRVSSSLTKHQVIHTVEKPYKCNSCGKVFSRNSHLAEHCRIHTGEKPYKCNVCGKVFSYNSNFARHQRIHTREKPYECNECGKVFSNNSYLARHQRIHAEEKPYKCNECGKGFSHKSSLANHWRIYTGEKPYKCDECGKAFYRIALLVRHQKIHTGEKPYKCNECGKVFIQNSHLAQHWRIHTGEKPYKCNECGKVFNQLSNLARHRRIHTGEKPYKCNECGKAFSEYSGLSAHLVIHTGEKPYKCSECGKAFRHKLSLTNHQRIHTGERPYKCNECGKVFNRIAHLARHRKIHTGEKPYKCNECGKAFSRISYLAQHWTIHMG
Protein accession: NP_653285.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00147657-B01P-13-15-1.jpg
Application image note: Western Blot analysis of ZNF480 expression in transfected 293T cell line (H00147657-T01) by ZNF480 MaxPab polyclonal antibody.

Lane 1: ZNF480 transfected lysate(56.76 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ZNF480 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart