PIK3R6 monoclonal antibody (M01), clone 1G16 View larger

PIK3R6 monoclonal antibody (M01), clone 1G16

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PIK3R6 monoclonal antibody (M01), clone 1G16

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about PIK3R6 monoclonal antibody (M01), clone 1G16

Brand: Abnova
Reference: H00146850-M01
Product name: PIK3R6 monoclonal antibody (M01), clone 1G16
Product description: Mouse monoclonal antibody raised against a partial recombinant PIK3R6.
Clone: 1G16
Isotype: IgG1 Kappa
Gene id: 146850
Gene name: PIK3R6
Gene alias: C17orf38|DKFZp666P158|FLJ34500|HsT41028|p84|p87(PIKAP)|p87PIKAP
Gene description: phosphoinositide-3-kinase, regulatory subunit 6
Genbank accession: NM_001010855
Immunogen: PIK3R6 (NP_001010855, 661 a.a. ~ 754 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GKSFSTVTNTFRTNNIQIQSRDQRLLTLSLDKDDQRTFRDVVRFEVAPCPEPCSGAQKSKAPWLNLHGQQEVEAIKAKPKPLLMPINTFSGIVQ
Protein accession: NP_001010855
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00146850-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.08 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PIK3R6 monoclonal antibody (M01), clone 1G16 now

Add to cart