RNF151 MaxPab mouse polyclonal antibody (B01) View larger

RNF151 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RNF151 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about RNF151 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00146310-B01
Product name: RNF151 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human RNF151 protein.
Gene id: 146310
Gene name: RNF151
Gene alias: MGC129921
Gene description: ring finger protein 151
Genbank accession: NM_174903.3
Immunogen: RNF151 (NP_777563.2, 1 a.a. ~ 245 a.a) full-length human protein.
Immunogen sequence/protein sequence: MGGGYDLNLFASPPDSNFVCSVCHGVLKRPARLPCSHIFCKKCILRWLARQKTCPCCRKEVKRKKVVHMNKLRKTIGRLEVKCKNADAGCIVTCPLAHRKGHQDSCPFELTACPNEGCTSQVPRGTLAEHRQHCQQGSQQRCPLGCGATLDPAERARHNCYRELHNAWSVRQERRRPLLLSLLRRVRWLDQATSVVRRELAELSNFLEEDTALLEGAPQEEAEAAPEGNVGAEVVGEPRANIPCK
Protein accession: NP_777563.2
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00146310-B01-13-15-1.jpg
Application image note: Western Blot analysis of RNF151 expression in transfected 293T cell line (H00146310-T01) by RNF151 MaxPab polyclonal antibody.

Lane1:RNF151 transfected lysate(26.95 KDa).
Lane2:Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy RNF151 MaxPab mouse polyclonal antibody (B01) now

Add to cart