ZFP90 MaxPab mouse polyclonal antibody (B01) View larger

ZFP90 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ZFP90 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about ZFP90 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00146198-B01
Product name: ZFP90 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human ZFP90 protein.
Gene id: 146198
Gene name: ZFP90
Gene alias: NK10|ZNF756
Gene description: zinc finger protein 90 homolog (mouse)
Genbank accession: BC033165
Immunogen: ZFP90 (AAH33165.1, 1 a.a. ~ 224 a.a) full-length human protein.
Immunogen sequence/protein sequence: MRIHKRGKPYQSSNYSIDFKHSTSLTQDESTLTEVKSYHCNDCGEDFSHITDFTDHQRIHTAENPYDCEQAFSQQAISHPGEKPYQCNVCGKAFKRSTSFIEHHRIHTGEKPYECNECGEAFSRRSSLTQHERTHTGEKPYECIDCGKAFSQSSSLIQHERTHTGEKPYECNECGRAFRKKTNLHDHQRIHTGEKPYSCKECGKNFSRSSALTKHQRIHTRNKL
Protein accession: AAH33165.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00146198-B01-13-15-1.jpg
Application image note: Western Blot analysis of ZFP90 expression in transfected 293T cell line (H00146198-T01) by ZFP90 MaxPab polyclonal antibody.

Lane 1: ZFP90 transfected lysate(24.64 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ZFP90 MaxPab mouse polyclonal antibody (B01) now

Add to cart