OTOA monoclonal antibody (M03), clone 1F5 View larger

OTOA monoclonal antibody (M03), clone 1F5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of OTOA monoclonal antibody (M03), clone 1F5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about OTOA monoclonal antibody (M03), clone 1F5

Brand: Abnova
Reference: H00146183-M03
Product name: OTOA monoclonal antibody (M03), clone 1F5
Product description: Mouse monoclonal antibody raised against a partial recombinant OTOA.
Clone: 1F5
Isotype: IgG2a Kappa
Gene id: 146183
Gene name: OTOA
Gene alias: DFNB22|FLJ32773|MGC157747|MGC39813
Gene description: otoancorin
Genbank accession: NM_144672
Immunogen: OTOA (NP_653273.3, 27 a.a. ~ 124 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: NSRQDLHPLLQNMAEEIIDGSYLNALLDLIQFQSSHVWTDDLSHRVLAYLNSRNVAFTIPSLQAAVENHLEQRLHQPQKLLEDLRKTDAQQFRTAMKC
Protein accession: NP_653273.3
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00146183-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.52 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00146183-M03-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged OTOA is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy OTOA monoclonal antibody (M03), clone 1F5 now

Add to cart