Brand: | Abnova |
Reference: | H00146059-M01 |
Product name: | CDAN1 monoclonal antibody (M01), clone 7A10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CDAN1. |
Clone: | 7A10 |
Isotype: | IgG2a Kappa |
Gene id: | 146059 |
Gene name: | CDAN1 |
Gene alias: | CDA-I|CDA1|CDAI|DLT|PRO1295|codanin |
Gene description: | congenital dyserythropoietic anemia, type I |
Genbank accession: | NM_138477 |
Immunogen: | CDAN1 (NP_612486.2, 1130 a.a. ~ 1227 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PLQLLLSPRNVGLLADTRPREWDLLLFLLRELVEKGLMGRMEIEACLGSLHQAQWPGDFAEELATLSNLFLAEPHLPEPQLRACELVQPNRGTVLAQS |
Protein accession: | NP_612486.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | CDAN1 monoclonal antibody (M01), clone 7A10. Western Blot analysis of CDAN1 expression in K-562. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |