Brand: | Abnova |
Reference: | H00146050-A01 |
Product name: | ZNF690 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant ZNF690. |
Gene id: | 146050 |
Gene name: | ZSCAN29 |
Gene alias: | FLJ35867|MGC129894|MGC129895|ZNF690|Zfp690 |
Gene description: | zinc finger and SCAN domain containing 29 |
Genbank accession: | NM_152455 |
Immunogen: | ZNF690 (NP_689668, 101 a.a. ~ 199 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | RPRSSVTVSVKGQEVRLEKMTPPKSSQELLSVRQESVEPQPRGVPKKERARSPDLGPQEQMNPKEKLKPFQRSGLPFPKSGVVSRLEQGEPWIPDLLGS |
Protein accession: | NP_689668 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | ZNF690 polyclonal antibody (A01), Lot # 061122JCS1 Western Blot analysis of ZNF690 expression in HL-60 ( Cat # L014V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |