MDP-1 purified MaxPab mouse polyclonal antibody (B01P) View larger

MDP-1 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MDP-1 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about MDP-1 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00145553-B01P
Product name: MDP-1 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human MDP-1 protein.
Gene id: 145553
Gene name: MDP-1
Gene alias: MGC5987
Gene description: magnesium-dependent phosphatase 1
Genbank accession: NM_138476.2
Immunogen: MDP-1 (NP_612485.2, 1 a.a. ~ 176 a.a) full-length human protein.
Immunogen sequence/protein sequence: MARLPKLAVFDLDYTLWPFWVDTHVDPPFHKSSDGTVRDRRGQDVRLYPEVPEVLKRLQSLGVPGAAASRTSEIEGANQLLELFDLFRYFVHREIYPGSKITHFERLQQKTGIPFSQMIFFDDERRNIVDVSKLGVTCIHIQNGMNLQTLSQGLETFAKAQTGPLRSSLEESPFEA
Protein accession: NP_612485.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00145553-B01P-13-15-1.jpg
Application image note: Western Blot analysis of MDP-1 expression in transfected 293T cell line (H00145553-T02) by MDP-1 MaxPab polyclonal antibody.

Lane 1: MGC5987 transfected lysate(19.36 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MDP-1 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart