GSC monoclonal antibody (M18), clone 4D6 View larger

GSC monoclonal antibody (M18), clone 4D6

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GSC monoclonal antibody (M18), clone 4D6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,IP

More info about GSC monoclonal antibody (M18), clone 4D6

Brand: Abnova
Reference: H00145258-M18
Product name: GSC monoclonal antibody (M18), clone 4D6
Product description: Mouse monoclonal antibody raised against a full length recombinant GSC.
Clone: 4D6
Isotype: IgG2b Kappa
Gene id: 145258
Gene name: GSC
Gene alias: -
Gene description: goosecoid homeobox
Genbank accession: NM_173849
Immunogen: GSC (NP_776248, 78 a.a. ~ 186 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LGYNNYFYGQLHVQAAPVGPACCGAVPPLGAQQCSCVPTPPGYEGPGSVLVSPVPHQMLPYMNVGTLSRTELQLLNQLHCRRKRRHRTIFTDEQLEALENLFQETKYPD
Protein accession: NP_776248
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00145258-M18-31-15-1.jpg
Application image note: Immunoprecipitation of GSC transfected lysate using anti-GSC monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with GSC MaxPab rabbit polyclonal antibody.
Applications: ELISA,IP
Shipping condition: Dry Ice

Reviews

Buy GSC monoclonal antibody (M18), clone 4D6 now

Add to cart