GSC monoclonal antibody (M14), clone 3G6 View larger

GSC monoclonal antibody (M14), clone 3G6

H00145258-M14_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GSC monoclonal antibody (M14), clone 3G6

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,ELISA

More info about GSC monoclonal antibody (M14), clone 3G6

Brand: Abnova
Reference: H00145258-M14
Product name: GSC monoclonal antibody (M14), clone 3G6
Product description: Mouse monoclonal antibody raised against a full length recombinant GSC.
Clone: 3G6
Isotype: IgG2b Kappa
Gene id: 145258
Gene name: GSC
Gene alias: -
Gene description: goosecoid homeobox
Genbank accession: NM_173849
Immunogen: GSC (NP_776248, 78 a.a. ~ 186 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LGYNNYFYGQLHVQAAPVGPACCGAVPPLGAQQCSCVPTPPGYEGPGSVLVSPVPHQMLPYMNVGTLSRTELQLLNQLHCRRKRRHRTIFTDEQLEALENLFQETKYPD
Protein accession: NP_776248
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00145258-M14-3-6-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to GSC on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]
Applications: IHC-P,ELISA
Shipping condition: Dry Ice

Reviews

Buy GSC monoclonal antibody (M14), clone 3G6 now

Add to cart