Brand: | Abnova |
Reference: | H00144715-A01 |
Product name: | RAD9B polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant RAD9B. |
Gene id: | 144715 |
Gene name: | RAD9B |
Gene alias: | FLJ40346|MGC75426 |
Gene description: | RAD9 homolog B (S. pombe) |
Genbank accession: | NM_152442 |
Immunogen: | RAD9B (NP_689655, 150 a.a. ~ 258 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | NVTGQALECISKKAAPRRLYPKETLTNISALENCGSPAMKRVDGDVSEVSESSVSNTEEVPGSLCLRKFSCMFFGAVSSDQQEHFNHPFDSLARASDSEEDMNNGSFSI |
Protein accession: | NP_689655 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (38.1 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | RAD9B polyclonal antibody (A01), Lot # 050919JC01 Western Blot analysis of RAD9B expression in HL-60 ( Cat # L014V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |