Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of A2ML1 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about A2ML1 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00144568-B01P |
| Product name: | A2ML1 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human A2ML1 protein. |
| Gene id: | 144568 |
| Gene name: | A2ML1 |
| Gene alias: | CPAMD9|DKFZp686C1729|DKFZp686D2011|DKFZp686G1812|DKFZp686L1821|DKFZp686O1010|FLJ16045|FLJ25179|FLJ39129|FLJ41597|FLJ41598|FLJ41607 |
| Gene description: | alpha-2-macroglobulin-like 1 |
| Genbank accession: | BC093840.1 |
| Immunogen: | A2ML1 (AAH93840.1, 1 a.a. ~ 158 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MYTLEASGQGCVYVQTVLRYNILPPTNMKTFSLSVEIGKARCEQPTSPRSLTLTIHTSYVGSRSSSNMAIVEVKMLSGFSPMEGTNQLLLQQPLVKKVEFGTDTLNIYLDELIKNTQTYTFTISQSVLVTNLKPATIKVYDYYLPDEQATIQYSDPCE |
| Protein accession: | AAH93840.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of A2ML1 expression in transfected 293T cell line (H00144568-T01) by A2ML1 MaxPab polyclonal antibody. Lane1:A2ML1 transfected lysate(17.38 KDa). Lane2:Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Laboratory diagnosis of paraneoplastic pemphigus.Poot AM, Diercks GF, Kramer D, Schepens I, Klunder G, Hashimoto T, Borradori L, Jonkman MF, Pas HH Br J Dermatol. 2013 Jun 25. doi: 10.1111/bjd.12479. |