GLIPR1L2 purified MaxPab mouse polyclonal antibody (B01P) View larger

GLIPR1L2 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of GLIPR1L2 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about GLIPR1L2 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00144321-B01P
Product name: GLIPR1L2 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human GLIPR1L2 protein.
Gene id: 144321
Gene name: GLIPR1L2
Gene alias: MGC39497
Gene description: GLI pathogenesis-related 1 like 2
Genbank accession: NM_152436.1
Immunogen: GLIPR1L2 (NP_689649.1, 1 a.a. ~ 253 a.a) full-length human protein.
Immunogen sequence/protein sequence: MEAARPFAREWRAQSLPLAVGGVLKLRLCELWLLLLGSSLNARFLPDEEDVDFINEYVNLHNELRGDVIPRGSNLRFMTWDVALSRTARAWGKKCLFTHNIYLQDVQMVHPKFYGIGENMWVGPENEFTASIAIRSWHAEKKMYNFENGSCSGDCSNYIQLVWDHSYKVGCAVTPCSKIGHIIHAAIFICNYAPGGTLTRRPYEPGIFCTRCGRRDKCTDFLCSKIKKINMKKMHNGLDKKNKRLNTSFLWSC
Protein accession: NP_689649.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00144321-B01P-13-15-1.jpg
Application image note: Western Blot analysis of GLIPR1L2 expression in transfected 293T cell line (H00144321-T01) by GLIPR1L2 MaxPab polyclonal antibody.

Lane 1: MGC39497 transfected lysate(27.83 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy GLIPR1L2 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart