MGC39497 MaxPab mouse polyclonal antibody (B01) View larger

MGC39497 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MGC39497 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about MGC39497 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00144321-B01
Product name: MGC39497 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human MGC39497 protein.
Gene id: 144321
Gene name: GLIPR1L2
Gene alias: MGC39497
Gene description: GLI pathogenesis-related 1 like 2
Genbank accession: NM_152436
Immunogen: MGC39497 (NP_689649, 1 a.a. ~ 253 a.a) full-length human protein.
Immunogen sequence/protein sequence: MEAARPFAREWRAQSLPLAVGGVLKLRLCELWLLLLGSSLNARFLPDEEDVDFINEYVNLHNELRGDVIPRGSNLRFMTWDVALSRTARAWGKKCLFTHNIYLQDVQMVHPKFYGIGENMWVGPENEFTASIAIRSWHAEKKMYNFENGSCSGDCSNYIQLVWDHSYKVGCAVTPCSKIGHIIHAAIFICNYAPGGTLTRRPYEPGIFCTRCGRRDKCTDFLCSKIKKINMKKMHNGLDKKNKRLNTSFLWSC
Protein accession: NP_689649
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00144321-B01-13-15-1.jpg
Application image note: Western Blot analysis of GLIPR1L2 expression in transfected 293T cell line (H00144321-T01) by GLIPR1L2 MaxPab polyclonal antibody.

Lane 1: MGC39497 transfected lysate(27.83 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MGC39497 MaxPab mouse polyclonal antibody (B01) now

Add to cart