Brand: | Abnova |
Reference: | H00143503-Q01 |
Product name: | OR51E1 (Human) Recombinant Protein (Q01) |
Product description: | Human OR51E1 partial ORF (NP_689643.1, 201 a.a. - 300 a.a.) recombinant protein with GST tag at N-terminal. |
Gene id: | 143503 |
Gene name: | OR51E1 |
Gene alias: | D-GPCR|FLJ13581|GPR136|GPR164|MGC24137|OR51E1P|OR52A3P|POGR|PSGR2 |
Gene description: | olfactory receptor, family 51, subfamily E, member 1 |
Genbank accession: | NM_152430.2 |
Immunogen sequence/protein sequence: | GLIVIISAIGLDSLLISFSYLLILKTVLGLTREAQAKAFGTCVSHVCAVFIFYVPFIGLSMVHRFSKRRDSPLPVILANIYLLVPPVLNPIVYGVKTKEI |
Protein accession: | NP_689643.1 |
Preparation method: | in vitro wheat germ expression system |
Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue |
Quality control testing picture: |  |
Note: | Best use within three months from the date of receipt of this protein. |
Tag: | GST |
Product type: | Proteins |
Antigen species / target species: | Human |
Applications: | AP,Array,ELISA,WB-Re |
Shipping condition: | Dry Ice |