DUSP19 purified MaxPab mouse polyclonal antibody (B01P) View larger

DUSP19 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DUSP19 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about DUSP19 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00142679-B01P
Product name: DUSP19 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human DUSP19 protein.
Gene id: 142679
Gene name: DUSP19
Gene alias: DUSP17|LMWDSP3|MGC138210|SKRP1|TS-DSP1
Gene description: dual specificity phosphatase 19
Genbank accession: BC035000
Immunogen: DUSP19 (AAH35000, 1 a.a. ~ 217 a.a) full-length human protein.
Immunogen sequence/protein sequence: MYSLNQEIKAFSRNNLRKQCTRVTTLTGKKIIETWKDARIHVVEEVEPSSGCGCGYVQDLSSDLQVGVIKPWLLLGSQDAAHDLDTLKKNKVTHILNVAYGVENAFLSDFTYKSISILDLPETNILSYFPECFEFIEEAKRKDGVVLVHCNAGVSRAAAIVIGFLMNSEQTSFTSAFSLVKNARPSICPNSGFMEQLRTYQEGKESDKCDRIQENSS
Protein accession: AAH35000
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00142679-B01P-13-15-1.jpg
Application image note: Western Blot analysis of DUSP19 expression in transfected 293T cell line (H00142679-T01) by DUSP19 MaxPab polyclonal antibody.

Lane 1: DUSP19 transfected lysate(23.98 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy DUSP19 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart