Brand: | Abnova |
Reference: | H00142678-M02 |
Product name: | MIB2 monoclonal antibody (M02), clone 3A7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MIB2. |
Clone: | 3A7 |
Isotype: | IgG2b Kappa |
Gene id: | 142678 |
Gene name: | MIB2 |
Gene alias: | FLJ20648|FLJ39787|ZZANK1|ZZZ5 |
Gene description: | mindbomb homolog 2 (Drosophila) |
Genbank accession: | BC037542 |
Immunogen: | MIB2 (AAH37542, 381 a.a. ~ 480 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | IGDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKVFGDGNLRVAVAGQRWTFSPSCLVAYRPEEDANLDVAERARENKSSLSVALDKLRAQKSDPEHPGRL |
Protein accession: | AAH37542 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged MIB2 is approximately 0.1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |