MIB2 monoclonal antibody (M02), clone 3A7 View larger

MIB2 monoclonal antibody (M02), clone 3A7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MIB2 monoclonal antibody (M02), clone 3A7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about MIB2 monoclonal antibody (M02), clone 3A7

Brand: Abnova
Reference: H00142678-M02
Product name: MIB2 monoclonal antibody (M02), clone 3A7
Product description: Mouse monoclonal antibody raised against a partial recombinant MIB2.
Clone: 3A7
Isotype: IgG2b Kappa
Gene id: 142678
Gene name: MIB2
Gene alias: FLJ20648|FLJ39787|ZZANK1|ZZZ5
Gene description: mindbomb homolog 2 (Drosophila)
Genbank accession: BC037542
Immunogen: MIB2 (AAH37542, 381 a.a. ~ 480 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: IGDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKVFGDGNLRVAVAGQRWTFSPSCLVAYRPEEDANLDVAERARENKSSLSVALDKLRAQKSDPEHPGRL
Protein accession: AAH37542
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00142678-M02-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged MIB2 is approximately 0.1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy MIB2 monoclonal antibody (M02), clone 3A7 now

Add to cart