Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MIB2 monoclonal antibody (M01A), clone 1B5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about MIB2 monoclonal antibody (M01A), clone 1B5
| Brand: | Abnova |
| Reference: | H00142678-M01A |
| Product name: | MIB2 monoclonal antibody (M01A), clone 1B5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MIB2. |
| Clone: | 1B5 |
| Isotype: | IgG2a Kappa |
| Gene id: | 142678 |
| Gene name: | MIB2 |
| Gene alias: | FLJ20648|FLJ39787|ZZANK1|ZZZ5 |
| Gene description: | mindbomb homolog 2 (Drosophila) |
| Genbank accession: | BC037542 |
| Immunogen: | MIB2 (AAH37542, 381 a.a. ~ 480 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | IGDLDTVKRLQAGHGEWTDDMAPALGRVGKVVKVFGDGNLRVAVAGQRWTFSPSCLVAYRPEEDANLDVAERARENKSSLSVALDKLRAQKSDPEHPGRL |
| Protein accession: | AAH37542 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Mind bomb-2 is an E3 ligase that ubiquitinates the nmda receptor NR2B subunit in a phosphorylation-dependent manner.Jurd R, Thornton C, Wang J, Luong K, Phamluong K, Kharazia V, Gibb SL, Ron D. J Biol Chem. 2008 Jan 4;283(1):301-10. Epub 2007 Oct 25. |