Brand: | Abnova |
Reference: | H00140856-M01 |
Product name: | C20orf79 monoclonal antibody (M01), clone 3C11 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant C20orf79. |
Clone: | 3C11 |
Isotype: | IgG2a Kappa |
Gene id: | 140856 |
Gene name: | C20orf79 |
Gene alias: | HSD22|MGC138229|dJ1068E13.2 |
Gene description: | chromosome 20 open reading frame 79 |
Genbank accession: | NM_178483.2 |
Immunogen: | C20orf79 (NP_848578.1, 1 a.a. ~ 156 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MWKRSDHQPKIKAEDGPLVGQFEVLGSVPEPAMPHPLELSEFESFPVFQDIRLHIREVGAQLVKKVNAVFQLDITKNGKTILRWTIDLKNGSGDMYPGPARLPADTVFTIPESVFMELVLGKMNPQKAFLAGKFKVSGKVLLSWKLERVFKDWAKF |
Protein accession: | NP_848578.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (44.1 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged C20orf79 is 3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |