Brand: | Abnova |
Reference: | H00140735-M04 |
Product name: | DYNLL2 monoclonal antibody (M04), clone 1G7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant DYNLL2. |
Clone: | 1G7 |
Isotype: | IgG2b Kappa |
Gene id: | 140735 |
Gene name: | DYNLL2 |
Gene alias: | DNCL1B|Dlc2|MGC17810 |
Gene description: | dynein, light chain, LC8-type 2 |
Genbank accession: | NM_080677 |
Immunogen: | DYNLL2 (NP_542408, 1 a.a. ~ 72 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKH |
Protein accession: | NP_542408 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (33.66 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged DYNLL2 is 0.3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |