ACTRT2 monoclonal antibody (M03), clone 2E10 View larger

ACTRT2 monoclonal antibody (M03), clone 2E10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ACTRT2 monoclonal antibody (M03), clone 2E10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,ELISA,WB-Re,WB-Tr

More info about ACTRT2 monoclonal antibody (M03), clone 2E10

Brand: Abnova
Reference: H00140625-M03
Product name: ACTRT2 monoclonal antibody (M03), clone 2E10
Product description: Mouse monoclonal antibody raised against a partial recombinant ACTRT2.
Clone: 2E10
Isotype: IgG2a Lambda
Gene id: 140625
Gene name: ACTRT2
Gene alias: ARPM2|ARPT2|Arp-T2|FLJ25424|HARPM2
Gene description: actin-related protein T2
Genbank accession: NM_080431
Immunogen: ACTRT2 (NP_536356, 209 a.a. ~ 299 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DKGLVDDIKKKLCYVALEPEKELSRRPEEVLREYKLPDGNIISLGDPLHQAPEALFVPQQLGSQSPGLSNMVSSSITKCDTDIQKILFGEI
Protein accession: NP_536356
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00140625-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.75 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00140625-M03-1-12-1.jpg
Application image note: ACTRT2 monoclonal antibody (M03), clone 2E10. Western Blot analysis of ACTRT2 expression in HepG2 ( Cat # L019V1 ).
Applications: WB-Ce,IHC-P,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ACTRT2 monoclonal antibody (M03), clone 2E10 now

Add to cart