Brand: | Abnova |
Reference: | H00140458-M03 |
Product name: | ASB5 monoclonal antibody (M03), clone 6B10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ASB5. |
Clone: | 6B10 |
Isotype: | IgG2a Kappa |
Gene id: | 140458 |
Gene name: | ASB5 |
Gene alias: | - |
Gene description: | ankyrin repeat and SOCS box-containing 5 |
Genbank accession: | NM_080874 |
Immunogen: | ASB5 (NP_543150, 220 a.a. ~ 328 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LLYAGADVQKGKYWDTPLHAAAQQSSTEIVNLLLEFGADINAKNTELLRPIDVATSSSMVERILLQHEATPSSLYQLCRLCIRSYIGKPRLHLIPQLQLPTLLKNFLQY |
Protein accession: | NP_543150 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged ASB5 is 1 ng/ml as a capture antibody. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |