Brand: | Abnova |
Reference: | H00140456-M01 |
Product name: | ASB11 monoclonal antibody (M01), clone 4D11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ASB11. |
Clone: | 4D11 |
Isotype: | IgG1 Kappa |
Gene id: | 140456 |
Gene name: | ASB11 |
Gene alias: | DKFZp779E2460|MGC119168|MGC119169 |
Gene description: | ankyrin repeat and SOCS box-containing 11 |
Genbank accession: | NM_080873 |
Immunogen: | ASB11 (NP_543149, 214 a.a. ~ 323 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KLLELGASVDHGQWLDTPLHAAARQSNVEVIHLLTDYGANLKRRNAQGKSALDLAAPKSSVEQALLLREGPPALSQLCRLCVRKCLGRACHQAIHKLHLPEPLERFLLYQ |
Protein accession: | NP_543149 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00140456-M01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00140456-M01-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00140456-M01-9-19-1.jpg](http://www.abnova.com/application_image/H00140456-M01-9-19-1.jpg) |
Application image note: | Detection limit for recombinant GST tagged ASB11 is approximately 1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |