FOXR2 monoclonal antibody (M01), clone 2C1 View larger

FOXR2 monoclonal antibody (M01), clone 2C1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FOXR2 monoclonal antibody (M01), clone 2C1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re

More info about FOXR2 monoclonal antibody (M01), clone 2C1

Brand: Abnova
Reference: H00139628-M01
Product name: FOXR2 monoclonal antibody (M01), clone 2C1
Product description: Mouse monoclonal antibody raised against a full length recombinant FOXR2.
Clone: 2C1
Isotype: IgG1 kappa
Gene id: 139628
Gene name: FOXR2
Gene alias: FOXN6|MGC21658
Gene description: forkhead box R2
Genbank accession: BC012934
Immunogen: FOXR2 (AAH12934, 1 a.a. ~ 311 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MDLKLKDCEFWYSLHGQVPGLLDWDMRNELFLPCTTDQCSLAEQILAKYRVGVMKPPEMPQKRRPSPDGDGPPCEPNLWMWVDPNILCPLGSQEAPKPSGKEDLTNISPFPQPPQKDEGSNCSEDKVVESLPSSSSEQSPLQKQGIHSPSDFELTEEEAEEPDDNSLQSPEMKCYQSQKLWQINNQEKSWQRPPLNCSHLIALALRNNPHCGLSVQEIYNFTRQHFPFFWTAPDGWKSTIHYNLCFLDSFEKVPDSLKDEDNARPRSCLWKLTKEGHRRFWEETRVLAFAQRERIQECMSQPELLTSLFDL
Protein accession: AAH12934
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00139628-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (59.95 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00139628-M01-3-41-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to FOXR2 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FOXR2 monoclonal antibody (M01), clone 2C1 now

Add to cart