DGKK monoclonal antibody (M01), clone 4G12 View larger

DGKK monoclonal antibody (M01), clone 4G12

H00139189-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of DGKK monoclonal antibody (M01), clone 4G12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about DGKK monoclonal antibody (M01), clone 4G12

Brand: Abnova
Reference: H00139189-M01
Product name: DGKK monoclonal antibody (M01), clone 4G12
Product description: Mouse monoclonal antibody raised against a partial recombinant DGKK.
Clone: 4G12
Isotype: IgG2a Kappa
Gene id: 139189
Gene name: DGKK
Gene alias: -
Gene description: diacylglycerol kinase, kappa
Genbank accession: NM_001013742
Immunogen: DGKK (NP_001013764, 1171 a.a. ~ 1271 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: AEDETALQSALDAMNKEFKKLSEIDWMNPIFVPEEKSSDTDSRSLRLKIKFPKLGKKKVEEERKPKSGQSVQSFIGNLWHRRHREDEAEGDDPLTPSRSQL
Protein accession: NP_001013764
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00139189-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.85 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00139189-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged DGKK is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy DGKK monoclonal antibody (M01), clone 4G12 now

Add to cart