Brand: | Abnova |
Reference: | H00139135-M10 |
Product name: | PASD1 monoclonal antibody (M10), clone 1C8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PASD1. |
Clone: | 1C8 |
Isotype: | IgG2b Kappa |
Gene id: | 139135 |
Gene name: | PASD1 |
Gene alias: | - |
Gene description: | PAS domain containing 1 |
Genbank accession: | NM_173493 |
Immunogen: | PASD1 (NP_775764, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MKMRGEKRRDKVNPKSSQRKLNWIPSFPTYDYFNQVTLQLLDGFMITLSTDGVIICVAENISSLLGHLPAEIVGKKLLSLLPDEEKDEVYQKIILKFPLL |
Protein accession: | NP_775764 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00139135-M10-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00139135-M10-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |