PASD1 monoclonal antibody (M07), clone 1F5 View larger

PASD1 monoclonal antibody (M07), clone 1F5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PASD1 monoclonal antibody (M07), clone 1F5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about PASD1 monoclonal antibody (M07), clone 1F5

Brand: Abnova
Reference: H00139135-M07
Product name: PASD1 monoclonal antibody (M07), clone 1F5
Product description: Mouse monoclonal antibody raised against a partial recombinant PASD1.
Clone: 1F5
Isotype: IgG2b Kappa
Gene id: 139135
Gene name: PASD1
Gene alias: -
Gene description: PAS domain containing 1
Genbank accession: NM_173493
Immunogen: PASD1 (NP_775764, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MKMRGEKRRDKVNPKSSQRKLNWIPSFPTYDYFNQVTLQLLDGFMITLSTDGVIICVAENISSLLGHLPAEIVGKKLLSLLPDEEKDEVYQKIILKFPLL
Protein accession: NP_775764
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00139135-M07-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PASD1 monoclonal antibody (M07), clone 1F5 now

Add to cart